PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aco005792.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Bromeliaceae; Ananas
Family Nin-like
Protein Properties Length: 917aa    MW: 101790 Da    PI: 6.3504
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aco005792.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK91.94.7e-29576626252
       RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  ek isle+l++yFs+++kdAAk+Lgvc+T++KriCRqyGI+RWP+Rki+++
  Aco005792.1 576 EKLISLEVLQQYFSGSLKDAAKSLGVCPTTMKRICRQYGISRWPSRKINKV 626
                  788**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.484565646IPR003035RWP-RK domain
PfamPF020426.6E-26579626IPR003035RWP-RK domain
SuperFamilySSF542775.23E-21816906No hitNo description
PROSITE profilePS5174522.727821903IPR000270PB1 domain
SMARTSM006664.6E-23821903IPR000270PB1 domain
PfamPF005641.4E-16821902IPR000270PB1 domain
Gene3DG3DSA:3.10.20.2407.7E-24821902No hitNo description
CDDcd064075.87E-35822902No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 917 aa     Download sequence    Send to blast
MQPPPDGIST LLRAHIVSLL RSRYCKYFPI PLFLFLFLFF FFFFLLMWGH TPRPPESERE  60
LAMDIDLDLD LDLDAFDAPA LASPLDLRRQ PGPRDLRGLS QIPLRTNANS KMLEIAALDG  120
NSDASCIIKE RMTQALRYFK ESTGQQVLVQ VWAPVKNGNR CVLTTSGQPF VLDPPRTKLL  180
QYRTVSLMYT FSVDEENGGY LGLPGRVFKQ KLPEWTPNVQ YYSSKEYLRL DHALLYNVRG  240
TLALPVFEPS GHSCLGVVEL IMTSQKINYA HDVDKVCKAL EICNEGRQAA LAEILEILTV  300
VCESQKLPLA QTWVPCKHRT ILAQGGGSIR NCLSFDGSCR GQVCMSTTDV AFYVVDAHMW  360
GFREGCVEHH LQKGQGVAGK AFETRRPCFC TDIQEFSKSK YPLVHYARMF GLSGCLAVCL  420
QSTLSGNDDY ILEFFLPSEC KNIREQRALL NAIATVMRQC FHSLKVVGDM NSQQLSFEII  480
DIIANQDCEL EPKSILDPSD DNYLCTFPVT SIPEGNDDSD NEGNASHDSR EQLCASDEGA  540
EKDGNIIVDH SGSGESRTVL SKKNNRPSGK KRGKAEKLIS LEVLQQYFSG SLKDAAKSLG  600
VCPTTMKRIC RQYGISRWPS RKINKVNRSL SKLKHVIESV QGIERTINLT SVPCPLPVAV  660
DSLSCPAKLD RSQTNIAIES DKDTLPLKMP EKDEINVQPG PRLDDVRGSK SSKSSSSSEG  720
SMNAPTSQGS CQGSPANEVL LDKTQIKQGA DTTAASRFPL QPIHYATDVD TQEQLPRKLI  780
RDSGSSKDLS NLCNAPMDGQ QVEPAVAPSN ILRHTAIQER TVTIKASYKY DIIRFKLHPD  840
DGIIAVKEEV AKRLKLEMGT FDIKYLDDDH EWVMLSCDAD LEECIEISRL SGAHVIRLLV  900
QDIVANHGSS CESSGD*
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1565573RPSGKKRGK
2568574GKKRGKA
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008806288.10.0PREDICTED: protein NLP3
SwissprotQ5NB820.0NLP3_ORYSJ; Protein NLP3
TrEMBLC5XJJ30.0C5XJJ3_SORBI; Putative uncharacterized protein Sb03g000490
STRINGSb03g000490.10.0(Sorghum bicolor)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP47783660
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G64530.10.0Nin-like family protein